Loading... Please wait...

Call 408-734-3800 / Toll Free 877-272-7241

Menu

EXED-002A

Exendin (9-39)

H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt)

$115.00
Quantity:

Product Description

Exendin (9-39) is a selective and potent against glucagon-like peptide 1 (GLP-1) and inhibits (Kd = 1.7 nm) cAMP production caused by Gastric Inhibitory Peptide (GIP). Exendin (9-39) is involved in appetite modulation by reducing insulin secretion and helps prevent sharp falls in glucose levels. This peptide has been studied for its’ effects on the permeability of basal microvascular.

SEQUENCE: H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

MOLECULAR FORMULA: C149H234N40O47S

MOLECULAR WEIGHT: 3369.79

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [133514-43-9]

SYNONYMS:

RESEARCH AREA: Diabetes

CATEGORY: Exendins »

REFERENCES:
Greig, NH. et al. Diabetolog 42, 45 (1999)
Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997)
Göke R. et al. J Biol Chem 268, 19650 (1993)
Eng, J. et al. J Biol Chem 267, 7402 (1992)

H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt)

H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 (trifluoroacetate salt)

Product Reviews

This product hasn't received any reviews yet. Be the first to review this product!

Customers also viewed

Related Products

Click the button below to add the Exendin (9-39) to your wish list.