Loading... Please wait...

Call 408-734-3800 / Toll Free 877-272-7241

Menu

GLUC-017A

GLP-1 (9-36) (human)

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt)

$95.00
Quantity:

Product Description

GLP-1 (9-36) is a truncated product from the degradation of GLP-1 (7-36) by dipeptidyl peptidase IV (DPP-4). The peptide is an antagonist to the GLP-1 (human) receptor and inhibits hepatic glucose production.

SEQUENCE: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

MOLECULAR FORMULA: C140H214N36O43

MOLECULAR WEIGHT: 3089.44

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [ 161748-29-4 ]

SYNONYMS:

RESEARCH AREA: Diabetes, Hormonal

CATEGORY: Glucagons and Glucagon-Like Peptides »

REFERENCES:
Ban, K. et. al. Endocrinol 151, 1520 (2010)
John, H. et al. Eur J Med Res 13, 73 (2008)
Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008)

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt)

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt)

Product Reviews

This product hasn't received any reviews yet. Be the first to review this product!

Related Products

Click the button below to add the GLP-1 (9-36) (human) to your wish list.