Loading... Please wait...

Call 408-734-3800 / Toll Free 877-272-7241

Menu

LL37-005A

Cys-LL-37

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

$160.00
Quantity:

Product Description

LL-37 with a N-terminal reduced cystein residue.

SEQUENCE: H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

MOLECULAR FORMULA: C208H345N61O54S1

MOLECULAR WEIGHT: 4596.47

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS: Cys-LL-37 peptide

RESEARCH AREA: Antimicrobial

CATEGORY: LL-37 and Fragments »

REFERENCES:
Schmidtchen A, Frick IM, Andersson E, Tapper H, Björck L. 2002.
Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol Microbiol. 2002 46(1):157-168.

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

Product Reviews

This product hasn't received any reviews yet. Be the first to review this product!

Customers also viewed

Related Products

Click the button below to add the Cys-LL-37 to your wish list.