Loading... Please wait...

Call 408-734-3800 / Toll Free 877-272-7241

Menu

LL37-005A

Cys-LL-37

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

$160.00
Quantity:

Product Description

LL-37 with a N-terminal reduced cystein residue.

SEQUENCE: H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

MOLECULAR FORMULA: C208H345N61O54S1

MOLECULAR WEIGHT: 4596.47

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS: Cys-LL-37 peptide

RESEARCH AREA: Antimicrobial

CATEGORY: LL-37 and Fragments »

REFERENCES:
Schmidtchen A, Frick IM, Andersson E, Tapper H, Björck L. 2002.
Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol Microbiol. 2002 46(1):157-168.

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH (trifluoroacetate salt)

Product Reviews

This product hasn't received any reviews yet. Be the first to review this product!

Related Products

Click the button below to add the Cys-LL-37 to your wish list.